PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G2195
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 556aa    MW: 60275.4 Da    PI: 6.7655
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G2195genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.63.6e-10414471562
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                  kr++r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +  l+++
  Gh_D02G2195 414 KRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQ 471
                  9********************************************9998877666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-18410474IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.737412475IPR004827Basic-leucine zipper domain
PfamPF001708.1E-9414468IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.32E-11414465No hitNo description
Gene3DG3DSA:1.20.5.1708.6E-11414470No hitNo description
CDDcd147037.73E-25415464No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MGDSEEGNTD LMQRIQSSFG TSSSSIPKQV LSMNHLEIPP LNPNQIRAVR HFSHFGQNFN  60
GGGGGGGGGG DGNKRVGIPP SHPNQIPPIS PYSQIPVSRP SSHQMGSSQG FSPGPTHSRS  120
LSQPSSFFSF DSLPPLSPAP VSQISNDVCM EDSHSLLPPS PFPKASSPRV GESLPPRKSH  180
RRSNSDIPFG FNTVMQSSPP PLRGSGFENS GVPRPVQLVK KETSWERGID GNVEGMGERK  240
SEGEVMDDLF SAYMNLDNID ALNSSEDKNN NNENHEDLDS RASGTKTNGG DSSDNEAESS  300
VNESGNSVTQ GGVYSTQKRE GNKRSAGGDI APTSRHYRSV SMDSFMGKLN FGDESPKLPP  360
SPGSRPGQLS PSNSIDGNSA AFSLELGNGE FNEAELKKIM ANEKLAEIAM TDPKRAKRIL  420
ANRQSAARSK ERKMRYISEL EHKVQTLQTE ATTLSAQLTL LQRDSVGLTN QNNELKFRIQ  480
SMEQQAQLRD ALNETLTAEV HRLKLATQEL GGNSDPSKGM VSQQLPISRQ MFQLHQQQFH  540
QQQQNGNTAA KSESNQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.78981e-149boll| leaf| ovule| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480420.10.0PREDICTED: transcription factor RF2a
RefseqXP_012480421.10.0PREDICTED: transcription factor RF2a
TrEMBLA0A0D2RL840.0A0A0D2RL84_G
STRINGPOPTR_0009s12830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-132bZIP family protein